| Edit |   |
| Antigenic Specificity | Gigaxonin |
| Clone | 4G7 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Gigaxonin Antibody (4G7) from Novus Biologicals is a mouse monoclonal antibody to Gigaxonin. This antibody reacts with human. The Gigaxonin Antibody (4G7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | GAN (NP_071324 534 a.a. - 597 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLDTGTNYDYVREFKRSTGTWHHTKPLLPSDLRRTGCAALRIANCKLFRLQLQQGLFRIRVHSP |
| Other Names | FLJ38059, GAN1KLHL16Kelch-like protein 16, giant axonal neuropathy (gigaxonin), gigaxonin |
| Gene, Accession # | GAN, Gene ID: 8139, Accession: NP_071324, SwissProt: NP_071324 |
| Catalog # | H00008139-M01 |
| Price | |
| Order / More Info | Gigaxonin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |