| Edit |   |
|---|
| Antigenic Specificity | RCDG1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RCDG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RCDG1. This antibody reacts with human. The RCDG1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LOC201725(hypothetical protein LOC201725) The peptide sequence was selected from the middle region of LOC201725. Peptide sequence VSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEEL. |
|---|
| Other Names | chromosome 4 open reading frame 46, hypothetical protein LOC201725, LOC201725 |
|---|
| Gene, Accession # | C4ORF46, Gene ID: 201725, Accession: Q504U0, SwissProt: Q504U0 |
|---|
| Catalog # | NBP1-56427 |
|---|
| Price | |
|---|
| Order / More Info | RCDG1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|