| Edit |   |
| Antigenic Specificity | RCDG1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RCDG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RCDG1. This antibody reacts with human. The RCDG1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LOC201725(hypothetical protein LOC201725) The peptide sequence was selected from the middle region of LOC201725. Peptide sequence VSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEEL. |
| Other Names | chromosome 4 open reading frame 46, hypothetical protein LOC201725, LOC201725 |
| Gene, Accession # | C4ORF46, Gene ID: 201725, Accession: Q504U0, SwissProt: Q504U0 |
| Catalog # | NBP1-56427-20ul |
| Price | |
| Order / More Info | RCDG1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |