| 产品详情 |
| Edit |   |
| Antigenic Specificity | DIS3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DIS3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DIS3. This antibody reacts with human. The DIS3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DIS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSSNLCSLKCDVDRLAFSCIWEMNHNAEILKTKFTKSVINSKASLTYAEAQLRIDSANMNDDITTSLRGLNKLAKILKKRRIEKGALTLSSPEV |
| Other Names | 2810028N01Rik, DIS3 mitotic control homolog (S. cerevisiae), dis3p, DKFZp667L1817, EC 3.1.13, EC 3.1.13.-, EC 3.1.26.-, EXOSC11, exosome complex exonuclease RRP44, exosome component 11, FLJ10484, KIAA1008RP11-342J4.3, MGC33035, mitotic control protein dis3 homolog, Protein DIS3 homolog, Ribosomal RNA-processing protein 44, RRP44bA555G22.1 |
| Gene, Accession # | DIS3, Gene ID: 22894 |
| Catalog # | NBP2-55359 |
| Price | |
| Order / More Info | DIS3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|