| Edit |   |
| Antigenic Specificity | DIRC2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DIRC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DIRC2. This antibody reacts with human. The DIRC2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to DIRC2(disrupted in renal carcinoma 2) The peptide sequence was selected from the middle region of DIRC2. Peptide sequence AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ. |
| Other Names | Disrupted in renal cancer protein 2, disrupted in renal carcinoma 2, disrupted in renal carcinoma protein 2, RCC4FLJ14784, renal cell carcinoma 4 |
| Gene, Accession # | DIRC2, Gene ID: 84925, Accession: Q96SL1, SwissProt: Q96SL1 |
| Catalog # | NBP1-59634-20ul |
| Price | |
| Order / More Info | DIRC2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |