| Edit |   |
|---|
| Antigenic Specificity | DIRC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DIRC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DIRC2. This antibody reacts with human. The DIRC2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DIRC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIAS |
|---|
| Other Names | Disrupted in renal cancer protein 2, disrupted in renal carcinoma 2, disrupted in renal carcinoma protein 2, RCC4FLJ14784, renal cell carcinoma 4 |
|---|
| Gene, Accession # | DIRC2, Gene ID: 84925 |
|---|
| Catalog # | NBP2-57469 |
|---|
| Price | |
|---|
| Order / More Info | DIRC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|