| Edit |   |
|---|
| Antigenic Specificity | Lysine Hydroxylase 2/PLOD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Lysine Hydroxylase 2/PLOD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lysine Hydroxylase 2/PLOD2. This antibody reacts with human. The Lysine Hydroxylase 2/PLOD2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | Synthetic peptides corresponding to PLOD2(procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2) The peptide sequence was selected from the middle region of PLOD2. Peptide sequence IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM. |
|---|
| Other Names | 2-oxoglutarate 5-dioxygenase (lysine hydroxylase) 2, 2-oxoglutarate 5-dioxygenase 2, procollagen-lysine, telopeptide lysyl hydroxylase |
|---|
| Gene, Accession # | PLOD2, Gene ID: 5352, Accession: O00469-2, SwissProt: O00469-2 |
|---|
| Catalog # | NBP1-58004 |
|---|
| Price | |
|---|
| Order / More Info | Lysine Hydroxylase 2/PLOD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|