| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BCCIP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BCCIP Antibody from Novus Biologicals is a rabbit polyclonal antibody to BCCIP. This antibody reacts with human. The BCCIP Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human BCCIP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALPMYQQLQKELAGAHRTNKPCGKCYFYLLISKTFVEAGKNNSKKKPSNKKKAALMFANAEEEFFYEEQGKPEVLGGPDTRRGLEPVPIQHNGGSR |
|---|
| Other Names | BCCIPalpha, BRCA2 and CDKN1A interacting protein, BRCA2 and CDKN1A-interacting protein, BRCA2 and Cip1/p21 interacting protein, cdk inhibitor p21 binding protein, P21- and CDK-associated protein 1, Protein TOK-1, TOK-1, TOK-1alpha, TOK1BCCIPbeta, TOK-1beta |
|---|
| Gene, Accession # | BCCIP, Gene ID: 56647 |
|---|
| Catalog # | NBP2-55218 |
|---|
| Price | |
|---|
| Order / More Info | BCCIP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|