| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNA Ligase I |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNA Ligase I Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNA Ligase I. This antibody reacts with human. The DNA Ligase I Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DNA Ligase I antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPL |
|---|
| Other Names | DNA ligase 1, DNA ligase I, EC 6.5.1.1, ligase I, DNA, ATP-dependent, MGC117397, MGC130025, Polydeoxyribonucleotide synthase [ATP] 1, polydeoxyribonucleotide synthase ATP 1 |
|---|
| Gene, Accession # | LIG1, Gene ID: 3978 |
|---|
| Catalog # | NBP2-55992 |
|---|
| Price | |
|---|
| Order / More Info | DNA Ligase I Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|