| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNALI1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNALI1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNALI1. This antibody reacts with human. The DNALI1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DNALI1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPPKTKLPSTPCVPDPTKQ |
|---|
| Other Names | dJ423B22.5, dynein, axonemal, light intermediate chain 1, dynein, axonemal, light intermediate polypeptide 1, hp28axonemal dynein light intermediate polypeptide 1, Inner dynein arm light chain, axonemal, inner dynein arm, homolog of clamydomonas, P28dJ423B22.5 (axonemal dynein light chain (hp28)) |
|---|
| Gene, Accession # | DNALI1, Gene ID: 7802 |
|---|
| Catalog # | NBP1-84222 |
|---|
| Price | |
|---|
| Order / More Info | DNALI1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24518672 |
|---|
| 产品资料 |
|
|