| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TIMP-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TIMP-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIMP-1. This antibody reacts with human. The TIMP-1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TIMP-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQ |
|---|
| Other Names | CLGI, Collagenase inhibitor, collagenase inhibitor), EPATIMP-1, EPO, erythroid potentiating activity, Erythroid-potentiating activity, Fibroblast collagenase inhibitor, FLJ90373, HCI, metalloproteinase inhibitor 1, TIMP metallopeptidase inhibitor 1, TIMPtissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, Tissue inhibitor of metalloproteinases 1 |
|---|
| Gene, Accession # | TIMP1, Gene ID: 7076, Accession: P01033, SwissProt: P01033 |
|---|
| Catalog # | NBP2-38700 |
|---|
| Price | |
|---|
| Order / More Info | TIMP-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|