| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TIMM8B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TIMM8B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIMM8B. This antibody reacts with human. The TIMM8B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TIMM8B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGG |
|---|
| Other Names | DDP2DDP-like protein, DDPL, Deafness dystonia protein 2, FLJ21744, MGC102866, MGC117373, mitochondrial import inner membrane translocase subunit Tim8 B, TIM8Btranslocase of inner mitochondrial membrane 8 (yeast) homolog B, translocase of inner mitochondrial membrane 8 homolog B (yeast) |
|---|
| Gene, Accession # | TIMM8B, Gene ID: 26521 |
|---|
| Catalog # | NBP1-84287 |
|---|
| Price | |
|---|
| Order / More Info | TIMM8B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|