| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TIMM8A |
|---|
| Clone | 2F11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TIMM8A Antibody (2F11) from Novus Biologicals is a mouse monoclonal antibody to TIMM8A. This antibody reacts with human. The TIMM8A Antibody (2F11) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | TIMM8A (NP_004076, 9 a.a. - 97 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD |
|---|
| Other Names | DDP1deafness/dystonia peptide, DDPMGC12262, Deafness dystonia protein 1, DFN1, mitochondrial import inner membrane translocase subunit Tim8 A, MTSTIM8, TIM8A, translocase of inner mitochondrial membrane 8 (yeast) homolog A, translocase of inner mitochondrial membrane 8 homolog A (yeast), X-linked deafness dystonia protein |
|---|
| Gene, Accession # | TIMM8A, Gene ID: 1678, Accession: NP_004076, SwissProt: NP_004076 |
|---|
| Catalog # | H00001678-M01 |
|---|
| Price | |
|---|
| Order / More Info | TIMM8A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|