| Edit |   |
|---|
| Antigenic Specificity | TIMM44 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TIMM44 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIMM44. This antibody reacts with human. The TIMM44 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TIMM44(translocase of inner mitochondrial membrane 44 homolog (yeast)) The peptide sequence was selected from the N terminal of TIMM44. Peptide sequence MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS |
|---|
| Other Names | MIMT44, mitochondrial import inner membrane translocase subunit TIM44, mitochondrial inner membrane translocase, TIM44DKFZp686H05241, translocase of inner mitochondrial membrane 44 homolog (yeast) |
|---|
| Gene, Accession # | TIMM44, Gene ID: 10469, Accession: O43615, SwissProt: O43615 |
|---|
| Catalog # | NBP1-54381-20ul |
|---|
| Price | |
|---|
| Order / More Info | TIMM44 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|