| 产品详情 |
| Edit |   |
| Antigenic Specificity | GO Protein alpha |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GO Protein alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to GO Protein alpha. This antibody reacts with human. The GO Protein alpha Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GO Protein alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECF |
| Other Names | DKFZp686O0962, G-ALPHA-o, GNAO, guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide O, guanine nucleotide binding protein, alpha activating polypeptide O, guanine nucleotide-binding protein G(o) subunit alpha |
| Gene, Accession # | GNAO1, Gene ID: 2775, Accession: P09471, SwissProt: P09471 |
| Catalog # | NBP2-38477 |
| Price | |
| Order / More Info | GO Protein alpha Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|