| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EpCAM/TROP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EpCAM/TROP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EpCAM/TROP1. This antibody reacts with human. The EpCAM/TROP1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human EpCAM/TROP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQN |
|---|
| Other Names | 17-1A, 323/A3, ACSTD1, antigen identified by monoclonal AUA1, CD326 antigen, Cell surface glycoprotein Trop-1, chromosome 4, surface marker (35kD glycoprotein), DIAR5, EGP, EGP-2, EGP314, EGP40, EpCAM, epithelial cell adhesion molecule, Epithelial cell surface antigen, Epithelial glycoprotein, Epithelial glycoprotein 314, ESA, GA733-2EGP34, hEGP314, HNPCC8, KS 1/4 antigen, KS1/4, KSAHEA125, M1S2, M4S1Ly74, Major gastrointestinal tumor-associated protein GA733-2, MIC18MH99, MOC31, TACST-1, TACSTD1, TROP1CD326, Tumor-associated calcium signal transducer 1CO-17A |
|---|
| Gene, Accession # | EPCAM, Gene ID: 4072 |
|---|
| Catalog # | NBP2-56894 |
|---|
| Price | |
|---|
| Order / More Info | EpCAM/TROP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|