| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SC5DL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SC5DL Antibody from Novus Biologicals is a rabbit polyclonal antibody to SC5DL. This antibody reacts with human. The SC5DL Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SC5DL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DLVLRVADYYFFTPYVYPATWPEDDIFRQAI |
|---|
| Other Names | 3beta-hydroxysteroid-delta5-desaturase, C-5 sterol desaturase, Delta(7)-sterol 5-desaturase, EC 1.14.21.6, ERG3, fungal ERG3, delta-5-desaturase-like, Lathosterol 5-desaturase, lathosterol dehydrogenase, lathosterol oxidase, S5DES, SC5D, Sterol-C5-desaturase, sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, fungal)-like, sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like, sterol-C5-desaturase (fungal ERG3, delta-5-desaturase)-like |
|---|
| Gene, Accession # | SC5DL, Gene ID: 6309 |
|---|
| Catalog # | NBP2-49478 |
|---|
| Price | |
|---|
| Order / More Info | SC5DL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|