| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFA12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFA12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFA12. This antibody reacts with human. The NDUFA12 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NDUFA12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMN |
|---|
| Other Names | 13 kDa differentiation-associated protein, B17.2,13kDa differentiation-associated protein, CIB17.2, CI-B17.2, complex I B17.2 subunit, Complex I-B17.2, DAP13NADH-ubiquinone oxidoreductase subunit B17.2, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12, NADH: ubiquinone oxidoreductase |
|---|
| Gene, Accession # | NDUFA12, Gene ID: 55967 |
|---|
| Catalog # | NBP1-88935 |
|---|
| Price | |
|---|
| Order / More Info | NDUFA12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|
| 产品资料 |
|
|