| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFA1 |
|---|
| Clone | 2A4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFA1 Antibody (2A4) from Novus Biologicals is a mouse monoclonal antibody to NDUFA1. This antibody reacts with human. The NDUFA1 Antibody (2A4) has been validated for the following applications: ELISA. |
|---|
| Immunogen | NDUFA1 (AAH00266, 1 a.a. - 70 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID |
|---|
| Other Names | CI-MWFEcomplex I MWFE subunit, Complex I-MWFE, MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa, NADH oxidoreductase subunit MWFE, NADH:ubiquinone oxidoreductase (complex 1), NADH-ubiquinone oxidoreductase MWFE subunit, type I dehydrogenase, ZNF183 |
|---|
| Gene, Accession # | NDUFA1, Gene ID: 4694, Accession: AAH00266, SwissProt: AAH00266 |
|---|
| Catalog # | H00004694-M10 |
|---|
| Price | |
|---|
| Order / More Info | NDUFA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|