| 产品详情 |
| Edit |   |
| Antigenic Specificity | NDUFA1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NDUFA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFA1. This antibody reacts with human. The NDUFA1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NDUFA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKG |
| Other Names | CI-MWFEcomplex I MWFE subunit, Complex I-MWFE, MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa, NADH oxidoreductase subunit MWFE, NADH:ubiquinone oxidoreductase (complex 1), NADH-ubiquinone oxidoreductase MWFE subunit, type I dehydrogenase, ZNF183 |
| Gene, Accession # | NDUFA1, Gene ID: 4694 |
| Catalog # | NBP2-56788 |
| Price | |
| Order / More Info | NDUFA1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|