| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDST3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDST3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDST3. This antibody reacts with human. The NDST3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NDST3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLPGTD |
|---|
| Other Names | bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3, EC 2.8.2.8, GlcNAc N-deacetylase/ N-sulfotransferase 3, Glucosaminyl N-deacetylase/N-sulfotransferase 3, hNDST-3, HSST3MGC130028, MGC130029, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3, NDST-3, N-heparan sulfate sulfotransferase 3, N-HSST 3 |
|---|
| Gene, Accession # | NDST3, Gene ID: 9348 |
|---|
| Catalog # | NBP2-49216 |
|---|
| Price | |
|---|
| Order / More Info | NDST3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|