| Edit |   |
| Antigenic Specificity | Syntenin 2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Syntenin 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Syntenin 2. This antibody reacts with human. The Syntenin 2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SDCBP2(syndecan binding protein (syntenin) 2) The peptide sequence was selected from the N terminal of SDCBP2. Peptide sequence VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ. |
| Other Names | FLJ12256, SITAC18ST-2, syndecan binding protein (syntenin) 2, Syndecan-binding protein 2, syntenin-2 |
| Gene, Accession # | SDCBP2, Gene ID: 27111, Accession: Q9H190-3, SwissProt: Q9H190-3 |
| Catalog # | NBP1-58969 |
| Price | |
| Order / More Info | Syntenin 2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |