| Edit |   |
|---|
| Antigenic Specificity | Syntenin 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Syntenin 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Syntenin 2. This antibody reacts with human. The Syntenin 2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SDCBP2(syndecan binding protein (syntenin) 2) The peptide sequence was selected from the N terminal of SDCBP2. Peptide sequence VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ. |
|---|
| Other Names | FLJ12256, SITAC18ST-2, syndecan binding protein (syntenin) 2, Syndecan-binding protein 2, syntenin-2 |
|---|
| Gene, Accession # | SDCBP2, Gene ID: 27111, Accession: Q9H190-3, SwissProt: Q9H190-3 |
|---|
| Catalog # | NBP1-58969-20ul |
|---|
| Price | |
|---|
| Order / More Info | Syntenin 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|