| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Syntenin 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Syntenin 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Syntenin 1. This antibody reacts with human. The Syntenin 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SDCBP(syndecan binding protein (syntenin)) The peptide sequence was selected from the middle region of SDCBP. Peptide sequence VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV. |
|---|
| Other Names | MDA9, MDA-9, melanoma differentiation associated protein-9, Melanoma differentiation-associated protein 9, Pro-TGF-alpha cytoplasmic domain-interacting protein 18, Scaffold protein Pbp1, ST1, SYCLTACIP18, syndecan binding protein (syntenin), Syndecan-binding protein 1, syntenin-1 |
|---|
| Gene, Accession # | SDCBP, Gene ID: 6386, Accession: O00560, SwissProt: O00560 |
|---|
| Catalog # | NBP1-59336 |
|---|
| Price | |
|---|
| Order / More Info | Syntenin 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|