| Edit |   |
|---|
| Antigenic Specificity | Syntaphilin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Syntaphilin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Syntaphilin. This antibody reacts with mouse. The Syntaphilin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is syntaphilin - N-terminal region. Peptide sequence YLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQEDWIEE. |
|---|
| Other Names | bA314N13.5, KIAA0374, MGC46096, syntaphilin |
|---|
| Gene, Accession # | SNPH, Gene ID: 9751, Accession: NP_937857 |
|---|
| Catalog # | NBP1-98477-20ul |
|---|
| Price | |
|---|
| Order / More Info | Syntaphilin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|