| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Syntabulin/GOLSYN |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Syntabulin/GOLSYN Antibody from Novus Biologicals is a rabbit polyclonal antibody to Syntabulin/GOLSYN. This antibody reacts with human. The Syntabulin/GOLSYN Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Syntabulin/GOLSYN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: STPGANVLELLPIVMGQEEGSVVVERAVQTDVVPYSPAISELIQSVLQKLQDPCPSSLASPDESEPDSMESFPESLSALVVDLTPRNPNSAI |
|---|
| Other Names | Golgi-Localized Protein, Golgi-Localized Syntaphilin-Related Protein, GOLSYN A Protein, GOLSYN B Protein, GOLSYN C Protein, Implicated In Syntaxin Trafficking In Neurons, KIAA1472, Microtubule-Associated Protein, OCSYN, SNPHL, SYBU, syntabulin, Syntabulin (Syntaxin-Interacting), syntaphilin-like, Syntaxin-1-Binding Protein |
|---|
| Gene, Accession # | SYBU, Gene ID: 55638, Accession: Q9NX95, SwissProt: Q9NX95 |
|---|
| Catalog # | NBP2-30921 |
|---|
| Price | |
|---|
| Order / More Info | Syntabulin/GOLSYN Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|