| Edit |   |
|---|
| Antigenic Specificity | SYNPO2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SYNPO2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SYNPO2. This antibody reacts with human. The SYNPO2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is SYNPO2 - C-terminal region. Peptide sequence FTFKEPKVSPNPELLSLLQNSEGKRGTGAGGDSGPEEDYLSLGAEACNFM. |
|---|
| Other Names | synaptopodin-2, synaptopodin 2 |
|---|
| Gene, Accession # | SYNPO2, Gene ID: 171024, Accession: NP_001122405, SwissProt: NP_001122405 |
|---|
| Catalog # | NBP1-98292-20ul |
|---|
| Price | |
|---|
| Order / More Info | SYNPO2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|