| 产品详情 |
| Edit |   |
| Antigenic Specificity | PADI4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PADI4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PADI4. This antibody reacts with human. The PADI4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PADI4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKKKSTGSSTWPLDPGVEVTLTMKVASGSTGDQKVQISYYGPKTPPVKALLYLTGV |
| Other Names | HL-60 PAD, PADI5PADI-H protein, PADPAD4, PDI4, PDI5EC 3.5.3.15, peptidyl arginine deiminase, type IV, peptidyl arginine deiminase, type V, Peptidylarginine deiminase IV, Protein-arginine deiminase type IV, protein-arginine deiminase type-4 |
| Gene, Accession # | PADI4, Gene ID: 23569, Accession: Q9UM07, SwissProt: Q9UM07 |
| Catalog # | NBP2-38499 |
| Price | |
| Order / More Info | PADI4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|