| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PAD3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunofluorescence in cell lines (ICC-IF) Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PAD3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PAD3. This antibody reacts with human. The PAD3 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PAD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRMLLASPGACFKLFQEKQKCGHGRALLFQGVVDDEQVKTISINQVLSNKDLINYNKFVQSCIDWNREV |
|---|
| Other Names | EC 3.5.3.15, MGC126307, PAD3, PDI3MGC126308, peptidyl arginine deiminase, type III, Peptidylarginine deiminase III, Protein-arginine deiminase type III, protein-arginine deiminase type-3 |
|---|
| Gene, Accession # | PADI3, Gene ID: 51702, Accession: Q9ULW8, SwissProt: Q9ULW8 |
|---|
| Catalog # | NBP1-92240 |
|---|
| Price | |
|---|
| Order / More Info | PAD3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|