| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GALNTL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GALNTL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GALNTL1. This antibody reacts with human. The GALNTL1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GALNTL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ATSTLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPH |
|---|
| Other Names | EC 2.4.1.41, GalNAc-T-like protein 1, GALNT16, KIAA1130GALNACT16, MGC141855, Polypeptide GalNAc transferase-like protein 1, polypeptide N-acetylgalactosaminyltransferase 16, pp-GaNTase-like protein 1, Protein-UDP acetylgalactosaminyltransferase-like protein 1, putative polypeptide N-acetylgalactosaminyltransferase-like protein 1, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 1, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase-like 1 |
|---|
| Gene, Accession # | GALNTL1, Gene ID: 57452, Accession: Q8N428, SwissProt: Q8N428 |
|---|
| Catalog # | NBP2-31747 |
|---|
| Price | |
|---|
| Order / More Info | GALNTL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|