| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GALNT6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GALNT6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GALNT6. This antibody reacts with human. The GALNT6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to GALNT6(UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6) The peptide sequence was selected from the N terminal of GALNT6. Peptide sequence MNNLRDSMPKLQIRAPEAQQTLFSINQSCL |
|---|
| Other Names | EC 2.4.1.41, GalNAc transferase 6, GalNAcT6, GALNAC-T6, Polypeptide GalNAc transferase 6, polypeptide N-acetylgalactosaminyltransferase 6, pp-GaNTase 6, Protein-UDP acetylgalactosaminyltransferase 6, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6, UDP-N-acetyl-alpha-D-galactosamine: polypeptideN-acetylgalactosaminyltransferase 6, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 6 (GalNAc-T6) |
|---|
| Gene, Accession # | GALNT6, Gene ID: 11226, Accession: Q8NCL4, SwissProt: Q8NCL4 |
|---|
| Catalog # | NBP1-69641 |
|---|
| Price | |
|---|
| Order / More Info | GALNT6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|