| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GALNT14 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GALNT14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GALNT14. This antibody reacts with human. The GALNT14 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human GALNT14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IREIILVDDFSNDPDDCKQLIKLPKVKCLRNNERQGLVRSRIRGADIAQGTTLTFLDSHCEVNRDWLQPLLHRVKEDYTRVVCPVIDIINLDTFTYIESASELRGGFDWSLHFQWEQL |
|---|
| Other Names | EC 2.4.1.41, FLJ12691, FLJ13977, GalNac-T10, GalNac-T14, GALNT15, Polypeptide GalNAc transferase 14, polypeptide N-acetylgalactosaminyltransferase 14, polypeptide N-acetylgalactosaminyltransferase 15, pp-GaNTase 14, Protein-UDP acetylgalactosaminyltransferase 14, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase T10, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase T14, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 14 (GalNAc-T14) |
|---|
| Gene, Accession # | GALNT14, Gene ID: 79623 |
|---|
| Catalog # | NBP2-56187 |
|---|
| Price | |
|---|
| Order / More Info | GALNT14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|