| 产品详情 |
| Edit |   |
| Antigenic Specificity | GALNT12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GALNT12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GALNT12. This antibody reacts with human. The GALNT12 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GALNT12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PEGCIAVEAGMDTLIMHLCEETAPENQKFILQEDGSLFHEQSKKCVQAAR KESSDSFVPLLRDCTNSDHQK |
| Other Names | colorectal cancer, susceptibility to 1, CRCS1, EC 2.4.1.41, FLJ21212, GalNAc-T12, Polypeptide GalNAc transferase 12, polypeptide N-acetylgalactosaminyltransferase 12, pp-GaNTase 12, Protein-UDP acetylgalactosaminyltransferase 12, UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferase, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 12, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 12 (GalNAc-T12) |
| Gene, Accession # | GALNT12, Gene ID: 79695 |
| Catalog # | NBP2-14035 |
| Price | |
| Order / More Info | GALNT12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|