| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CELA1 |
|---|
| Clone | 4H5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CELA1 Antibody (4H5) from Novus Biologicals is a mouse monoclonal antibody to CELA1. This antibody reacts with human. The CELA1 Antibody (4H5) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | ELA1 (NP_001962.3 159 a.a. - 257 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIAS |
|---|
| Other Names | chymotrypsin-like elastase family member 1, chymotrypsin-like elastase family, member 1, EC 3.4.21, EC 3.4.21.36, ELA1elastase-1, elastase 1, pancreatic, Elastase-1 |
|---|
| Gene, Accession # | CELA1, Gene ID: 1990, Accession: NP_001962, SwissProt: NP_001962 |
|---|
| Catalog # | H00001990-M02 |
|---|
| Price | |
|---|
| Order / More Info | CELA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|