| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CEECAM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CEECAM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CEECAM1. This antibody reacts with human. The CEECAM1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CEECAM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDG |
|---|
| Other Names | CEECAM1, CerCAM, cerebral endothelial cell adhesion molecule 1, cerebral endothelial cell adhesion moleculeMGC149621, GLT25D3cerebral cell adhesion molecule, glycosyltransferase 25 domain containing 3, glycosyltransferase 25 family member 3, KIAA1502, MGC149620 |
|---|
| Gene, Accession # | CERCAM, Gene ID: 51148 |
|---|
| Catalog # | NBP1-84551 |
|---|
| Price | |
|---|
| Order / More Info | CEECAM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|