| 产品详情 |
| Edit |   |
| Antigenic Specificity | SAFB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SAFB Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAFB. This antibody reacts with human. The SAFB Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SAFB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFTILQ |
| Other Names | glutathione S-transferase fusion protein, HAP, heat-shock protein (HSP27) estrogen response element and TATA box-bindingprotein, HETDKFZp779C1727, Hsp27 ERE-TATA binding protein, HSP27 ERE-TATA-binding protein, HSP27 estrogen response element-TATA box-binding protein, SAF-B, SAF-B1, SAFB1SAB-B1, scaffold attachment factor B, scaffold attachment factor B1 |
| Gene, Accession # | SAFB, Gene ID: 6294 |
| Catalog # | NBP1-83265 |
| Price | |
| Order / More Info | SAFB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|