| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SAE2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SAE2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAE2. This antibody reacts with human. The SAE2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human SAE2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNNAD |
|---|
| Other Names | Anthracycline-associated resistance ARX, ARX, EC 6.3.2, EC 6.3.2.-, FLJ13058, HRIHFB2115, SAE2SUMO-1 activating enzyme subunit 2, SUMO1 activating enzyme subunit 2, SUMO-activating enzyme subunit 2, UBA2, ubiquitin-activating enzyme E1 homolog, Ubiquitin-like 1-activating enzyme E1B, ubiquitin-like modifier activating enzyme 2, UBLE1B |
|---|
| Gene, Accession # | UBA2, Gene ID: 10054, Accession: Q9UBT2, SwissProt: Q9UBT2 |
|---|
| Catalog # | NBP2-34070 |
|---|
| Price | |
|---|
| Order / More Info | SAE2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|