| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SACM1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SACM1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to SACM1L. This antibody reacts with human. The SACM1L Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SACM1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKT |
|---|
| Other Names | DKFZp686A0231, EC 3.1.3, EC 3.1.3.36, EC 3.1.3.77, KIAA0851suppressor of actin 1, phosphatidylinositide phosphatase SAC1, SAC1 suppressor of actin mutations 1-like (yeast), SAC1EC 3.1.3.-, Suppressor of actin mutations 1-like protein |
|---|
| Gene, Accession # | SACM1L, Gene ID: 22908 |
|---|
| Catalog # | NBP2-55859 |
|---|
| Price | |
|---|
| Order / More Info | SACM1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|