| Edit |   |
| Antigenic Specificity | LRRC32/GARP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRRC32/GARP Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC32/GARP. This antibody reacts with human. The LRRC32/GARP Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEK |
| Other Names | D11S833Eleucine-rich repeat-containing protein 32, GARPGarpin, Glycoprotein A repetitions predominantgarpin, leucine rich repeat containing 32 |
| Gene, Accession # | LRRC32, Gene ID: 2615 |
| Catalog # | NBP2-68740 |
| Price | |
| Order / More Info | LRRC32/GARP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |