| Edit |   |
| Antigenic Specificity | LRRC10B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRRC10B Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC10B. This antibody reacts with human. The LRRC10B Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LRRC10B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPADFAQLQSLRCLWIEGNFLRRF |
| Other Names | Leucine Rich Repeat Containing 10B, Leucine-Rich Repeat-Containing Protein 10B, LRRC10-Like Protein ENSP00000367315 |
| Gene, Accession # | LRRC10B, Gene ID: 390205, Accession: A6NIK2, SwissProt: A6NIK2 |
| Catalog # | NBP2-33493 |
| Price | |
| Order / More Info | LRRC10B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |