| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PXR/NR1I2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PXR/NR1I2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PXR/NR1I2. This antibody reacts with human. The PXR/NR1I2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PXR/NR1I2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADE |
|---|
| Other Names | nuclear receptor subfamily 1 group I member 2, nuclear receptor subfamily 1, group I, member 2, ONR1, Orphan nuclear receptor PAR1, Orphan nuclear receptor PXR, PAR, PAR1, PAR2, Pregnane X receptor, PRR, PXRPARq, SAR, Steroid and xenobiotic receptor, SXRBXR |
|---|
| Gene, Accession # | NR1I2, Gene ID: 8856 |
|---|
| Catalog # | NBP2-55441 |
|---|
| Price | |
|---|
| Order / More Info | PXR/NR1I2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|