| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kv9.3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kv9.3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kv9.3. This antibody reacts with human. The Kv9.3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Kv9 |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA |
|---|
| Other Names | delayed-rectifier K(+) channel alpha subunit 3, KV9.3, MGC9481, potassium voltage-gated channel subfamily S member 3, potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3, Shab-related delayed-rectifier K+ channel alpha subunit 3, voltage-gated potassium channel protein Kv9.3, voltage-gated potassium channel subunit Kv9.3 |
|---|
| Gene, Accession # | KCNS3, Gene ID: 3790 |
|---|
| Catalog # | NBP1-81334 |
|---|
| Price | |
|---|
| Order / More Info | Kv9.3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|