| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kv7.2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kv7.2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kv7.2. This antibody reacts with human. The Kv7.2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Kv7 |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RLGKVEKQVLSMEKKLDFLVNIYMQRMGIPPTETEAYFGAKEPEPAPPYHSPEDSREHVDRHGCIVKIVRSSSST |
|---|
| Other Names | BFNC, BFNS1, EBN, EBN1, EIEE7, ENB1, HNSPC, KCNA11, KQT-like 2, Kv7.2, KVEBN1, neuroblastoma-specific potassium channel protein, Neuroblastoma-specific potassium channel subunit alpha KvLQT2, potassium voltage-gated channel subfamily KQT member 2, potassium voltage-gated channel, KQT-like subfamily, member 2, Voltage-gated potassium channel subunit Kv7.2 |
|---|
| Gene, Accession # | KCNQ2, Gene ID: 3785, Accession: O43526, SwissProt: O43526 |
|---|
| Catalog # | NBP2-38820 |
|---|
| Price | |
|---|
| Order / More Info | Kv7.2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|