| 产品详情 |
| Edit |   |
| Antigenic Specificity | ISCU |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ISCU Antibody from Novus Biologicals is a rabbit polyclonal antibody to ISCU. This antibody reacts with human. The ISCU Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ISCU antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFK |
| Other Names | 2310020H20Rik, HML, hnifU, iron-sulfur cluster assembly enzyme ISCU, mitochondrial, iron-sulfur cluster scaffold homolog (E. coli), IscU, IscU iron-sulfur cluster scaffold homolog, IscU iron-sulfur cluster scaffold homolog (E. coli), ISU2, MGC74517, NIFU, NifU-like N-terminal domain containing, NifU-like N-terminal domain-containing protein, NifU-like protein, NIFUN |
| Gene, Accession # | ISCU, Gene ID: 23479, Accession: Q9H1K1, SwissProt: Q9H1K1 |
| Catalog # | NBP2-38829 |
| Price | |
| Order / More Info | ISCU Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|