| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Prokineticin R2/PROKR2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Prokineticin R2/PROKR2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Prokineticin R2/PROKR2. This antibody reacts with human. The Prokineticin R2/PROKR2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ProkineticinR2/PROKR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTF |
|---|
| Other Names | dJ680N4.3, G protein-coupled receptor 73-like 1, GPR73bG-protein coupled receptor 73-like 1, GPR73L1Kallmann syndrome 3 (autosomal dominant), GPRg2KAL3, PKR2PK-R2, prokineticin receptor 2 |
|---|
| Gene, Accession # | PROKR2, Gene ID: 128674 |
|---|
| Catalog # | NBP1-92290 |
|---|
| Price | |
|---|
| Order / More Info | Prokineticin R2/PROKR2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|