| 产品详情 |
| Edit |   |
| Antigenic Specificity | Integrin alpha 2b/CD41 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point. Simple Western verified by a customer review. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Integrin alpha 2b/CD41 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Integrin alpha 2b/CD41. This antibody reacts with human. The Integrin alpha 2b/CD41 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAV |
| Other Names | CD41, CD41 antigen, CD41BHPA3, GP2Bintegrin alpha-IIb, GPalpha IIb, GPIIb, GTA, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41), integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41B), ITGAB, platelet fibrinogen receptor, alpha subunit, Platelet membrane glycoprotein IIb, platelet-specific antigen BAK |
| Gene, Accession # | ITGA2B, Gene ID: 3674 |
| Catalog # | NBP1-84581-25ul |
| Price | |
| Order / More Info | Integrin alpha 2b/CD41 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|