| Edit |   |
| Antigenic Specificity | Opticin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Opticin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Opticin. This antibody reacts with human. The Opticin Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human OPTCThe immunogen for this antibody is OPTC (NP_055174). Peptide sequence LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED. |
| Other Names | oculoglycan, OPT, opticin |
| Gene, Accession # | OPTC, Gene ID: 26254, Accession: Q9UBM4, SwissProt: Q9UBM4 |
| Catalog # | NBP1-79568 |
| Price | |
| Order / More Info | Opticin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |