| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OPALIN |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. IHC-Fr reported in scientific literature (PMID: 24920622). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OPALIN Antibody from Novus Biologicals is a rabbit polyclonal antibody to OPALIN. This antibody reacts with human, mouse. The OPALIN Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Specificity of human OPALIN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RRRSSIEAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIEMERRRGLWWLVPRLSLE |
|---|
| Other Names | HTMP10transmembrane protein TMP10, oligodendrocytic myelin paranodal and inner loop proteinTMEM10, TMP10, Transmembrane protein 10opalin |
|---|
| Gene, Accession # | OPALIN, Gene ID: 93377 |
|---|
| Catalog # | NBP1-81656 |
|---|
| Price | |
|---|
| Order / More Info | OPALIN Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261, 24920622 |
|---|
| 产品资料 |
|
|