| Edit |   |
|---|
| Antigenic Specificity | SOX4 |
|---|
| Clone | 1E5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SOX4 Antibody (1E5) from Novus Biologicals is a mouse monoclonal antibody to SOX4. This antibody reacts with human. The SOX4 Antibody (1E5) has been validated for the following applications: ELISA. |
|---|
| Immunogen | SOX4 (NP_003098, 45 a.a. - 136 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS |
|---|
| Other Names | ecotropic viral integration site 16, EVI16, SRY (sex determining region Y)-box 4, SRY-related HMG-box gene 4, transcription factor SOX-4 |
|---|
| Gene, Accession # | SOX4, Gene ID: 6659, Accession: NP_003098, SwissProt: NP_003098 |
|---|
| Catalog # | H00006659-M02 |
|---|
| Price | |
|---|
| Order / More Info | SOX4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|