| Edit |   |
| Antigenic Specificity | SOX22 |
| Clone | 2C4 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2b kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SOX22 Antibody (2C4) from Novus Biologicals is a mouse monoclonal antibody to SOX22. This antibody reacts with human. The SOX22 Antibody (2C4) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | SOX12 (NP_008874 252 a.a. - 313 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF |
| Other Names | Protein SOX-22, SOX-22 protein, SOX22transcription factor SOX-12, SRY (sex determining region Y)-box 12, SRY (sex determining region Y)-box 22, SRY-related HMG-box gene 22 |
| Gene, Accession # | SOX12, Gene ID: 6666, Accession: NP_008874, SwissProt: NP_008874 |
| Catalog # | H00006666-M01 |
| Price | |
| Order / More Info | SOX22 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |